PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Han000266
Common Namekn2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Heliantheae alliance; Heliantheae; Helianthus
Family TALE
Protein Properties Length: 358aa    MW: 40868.6 Da    PI: 6.2376
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Han#S18764407PU_refUnigeneView CDS
PUT-169a-Helianthus_annuus-28512PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.3e-092823172055
                HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
   Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  Han000266 282 YKWPYPSESEKVALAESTGLDQKQINNWFINQRKRH 317
                4679*****************************885 PP

2ELK37.93.7e-13237258122
        ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                ELK++LlrKYsgyL+sLkqE+s
  Han000266 237 ELKNHLLRKYSGYLSSLKQELS 258
                9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.9E-2283127IPR005540KNOX1
PfamPF037909.1E-2384125IPR005540KNOX1
SMARTSM012567.7E-28134185IPR005541KNOX2
PfamPF037916.9E-24140184IPR005541KNOX2
PfamPF037892.5E-10237258IPR005539ELK domain
SMARTSM011883.5E-7237258IPR005539ELK domain
PROSITE profilePS5121311.296237257IPR005539ELK domain
PROSITE profilePS5007113.086257320IPR001356Homeobox domain
SuperFamilySSF466896.84E-20258332IPR009057Homeodomain-like
SMARTSM003892.4E-13259324IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.8E-28262323IPR009057Homeodomain-like
CDDcd000861.67E-12269321No hitNo description
PfamPF059201.0E-16277316IPR008422Homeobox KN domain
PROSITE patternPS000270295318IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MEDYLGQNSS SSNTGTTSTT FLYGSGGVAP DTSCLYGRGG NESDPGHGGF HHPDQYHHPM  60
VKIETEKFHN YPPSMVNFHN EDEALKAKII SHPHYSNLLQ AYMDCQKVGA PPEVVGRLTA  120
VRQEYEARQR ANLGCRENYK DPELDQFMEA YYDMLIKYKE ELTRPIQEAM EFMRRIESQL  180
STLTISSSSS SSPAGRIFIS PDESKCEVIG SSDEEQENTS GGETEVAEID PRAEDRELKN  240
HLLRKYSGYL SSLKQELSKK KKKGKLPKEA RQKLLSWWEL HYKWPYPSES EKVALAESTG  300
LDQKQINNWF INQRKRHWKP SEDMQFMVMD GLHPQNVATA LYMGDHHYMG DGPYRLGP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002285521.11e-155PREDICTED: homeobox protein knotted-1-like 2
SwissprotO041351e-152KNAP2_MALDO; Homeobox protein knotted-1-like 2
TrEMBLQ8LPN00.0Q8LPN0_HELAN; Knotted-1-like protein 2
STRINGVIT_18s0001g08380.t011e-155(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-130KNOTTED-like from Arabidopsis thaliana
Publications ? help Back to Top
  1. Tioni MF,Gonzalez DH,Chan RL
    Knotted1-like genes are strongly expressed in differentiated cell types in sunflower.
    J. Exp. Bot., 2003. 54(383): p. 681-90
    [PMID:12554711]